General Information

  • ID:  hor000692
  • Uniprot ID:  P49192
  • Protein name:  Cocaine-amphetamine-regulated transcript protein
  • Gene name:  Cartpt
  • Organism:  Rattus norvegicus (Rat)
  • Family:  CART family
  • Source:  Animal
  • Expression:  By cocaine and amphetamine.|Neuroendocrine tissues. Predominantly expressed in the hypothalamus, pituitary, and longitudinal muscle-myenteric plexus. Abundant expression is also seen in the midbrain/thalamus and eye. A lower level expression is seen in th
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0001678 intracellular glucose homeostasis; GO:0001696 gastric acid secretion; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0008343 adult feeding behavior; GO:0009267 cellular response to starvation; GO:0032099 negative regulation of appetite; GO:0032812 positive regulation of epinephrine secretion; GO:0032922 circadian regulation of gene expression; GO:0043410 positive regulation of MAPK cascade; GO:0045777 positive regulation of blood pressure; GO:0045779 negative regulation of bone resorption; GO:0045860 positive regulation of protein kinase activity; GO:0046850 regulation of bone remodeling; GO:0050796 regulation of insulin secretion; GO:0051971 positive regulation of transmission of nerve impulse; GO:0070093 negative regulation of glucagon secretion; GO:0070253 somatostatin secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0045202 synapse

Sequence Information

  • Sequence:  IPIYE
  • Length:  5(82-86)
  • Propeptide:  MESSRLRLLPVLGAALLLLLPLLGAGAQEDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
  • Signal peptide:  MESSRLRLLPVLGAALLLLLPLLGAGA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P49192-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000692_AF2.pdbhor000692_ESM.pdb

Physical Information

Mass: 70527 Formula: C31H47N5O9
Absent amino acids: ACDFGHKLMNQRSTVW Common amino acids: I
pI: 3.85 Basic residues: 0
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: 52 Boman Index: 289
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 156
Instability Index: -1284 Extinction Coefficient cystines: 1490
Absorbance 280nm: 372.5

Literature

  • PubMed ID:  12716136
  • Title:  Peptidomics-based Discovery of Novel Neuropeptides